PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009785426.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BES1
Protein Properties Length: 323aa    MW: 34940 Da    PI: 8.205
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009785426.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222075.1e-6421451148
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r p+wkErEnnkrRERrRRaiaaki+aGLR++Gn+klpk++DnneVlkALc+eAGw+ve+DGtty+kg+kp ++++ +  sas+sp+ss+q
  XP_009785426.1   2 TSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAGWIVEEDGTTYKKGCKPVQRMDNICYSASVSPCSSYQ 96 
                     5899******************************************************************************************* PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvss 148
                             +sp +sy++sp+sssfpsp+s+  i +a++    +sl+p+l++ls+ ss
  XP_009785426.1  97 --------PSPGASYNPSPASSSFPSPVSSHYIANAQNntdpNSLIPWLKNLSSGSS 145
                     ........9********************9999888778999*********998443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.6E-654141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTSGTRLPSW KERENNKRRE RRRRAIAAKI FAGLRMYGNF KLPKHCDNNE VLKALCNEAG  60
WIVEEDGTTY KKGCKPVQRM DNICYSASVS PCSSYQPSPG ASYNPSPASS SFPSPVSSHY  120
IANAQNNTDP NSLIPWLKNL SSGSSPSSSK FPHHLYIPGS SISAPVTPPL SSPTAHTPRM  180
RDDPKANSTW IRQNYAFLPS STPASPGCQT PLDSGWLSGV QTPQDEPSSP TFSLVSPNPF  240
GFREPLSNGG SRMWTPGQSG VCSPAIGAGI DQTADVPMSD AISAEFAFGS NMKGLVKPWE  300
GERIHEECLT DDLELTLGNS STK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009785426.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-127BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLK4BE221e-179K4BE22_SOLLC; Uncharacterized protein
TrEMBLM1CNX31e-179M1CNX3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000715111e-178(Solanum tuberosum)
STRINGSolyc03g005990.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-104BES1/BZR1 homolog 4